PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G46450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 525aa    MW: 57314 Da    PI: 9.9498
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G46450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-17116162148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT +Ede l++ v ++G + W+tIa+ ++ gR +kqc++rw ++l
     OB01G46450.1 116 KGAWTRQEDEVLKQMVILHGDRKWSTIAKSLP-GRIGKQCRERWTNHL 162
                      79******************************.************996 PP

2Myb_DNA-binding54.42.9e-17168210145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ WT+e+d  l++a+k +G++ W+ Iar+++ gR+++ +k++w+
     OB01G46450.1 168 KDVWTEEDDAMLIEAHKTYGNR-WSVIARCLP-GRSENAVKNHWN 210
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.272111166IPR017930Myb domain
SuperFamilySSF466891.5E-29114209IPR009057Homeodomain-like
SMARTSM007178.9E-16115164IPR001005SANT/Myb domain
PfamPF002493.2E-15116162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-24117167IPR009057Homeodomain-like
CDDcd001671.99E-14118162No hitNo description
SMARTSM007178.6E-18167215IPR001005SANT/Myb domain
PROSITE profilePS5129418.173167217IPR017930Myb domain
PfamPF002496.6E-15168210IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-21168214IPR009057Homeodomain-like
CDDcd001672.92E-14171213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MVPTLKDELT AAAGNSFINQ DLVMAGAGMP TRYFASSSHG TGAHYQSSSS APITMAVPDV  60
GFLIAGIGMA PSSFVLPEGA LGAGFSNMGA VPVGVVVPRQ QHTRVGGSNG NPGPFKGAWT  120
RQEDEVLKQM VILHGDRKWS TIAKSLPGRI GKQCRERWTN HLRPDIKKDV WTEEDDAMLI  180
EAHKTYGNRW SVIARCLPGR SENAVKNHWN ATKRSLKSKR RTKKNKSEQA QLAAMNLNMS  240
LAPNLNASYN EQQDGYYLPF DVPQGNIHYG APPVQQQGIS VGHDLHSSCL SLYHPSLPGS  300
HPIGVELGGY YSEAGPSSGS VSGVDPDDID VIQMASRQFL VPSEAEVTLD LTRFNLEQPA  360
KQHKGIPSAP CCKRVAQAIH VGESPPWRRQ RQKSCSCKCR SVFARAQTRP VVVPCLPGSI  420
RVRSCRAFCR ARPPCLGPAQ KSTAQFPALT PPAAAAPGSG ELQPFPTRLN ATVSLRVTSG  480
EVPRLTAESY TEQNRRWDKH MRVYEKVNHN HRLHGNRYHT GTSWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-401102121103B-MYB
1h89_C3e-3911121453156MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-3911121453156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645039.21e-156PREDICTED: protein rough sheath 2-like
TrEMBLJ3L5Y90.0J3L5Y9_ORYBR; Uncharacterized protein
STRINGOB01G46450.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.18e-44myb domain protein 118